PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00092.1_g00047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 263aa    MW: 30226.2 Da    PI: 10.2167
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00092.1_g00047.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.97.8e-1339942990
                             -..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                       B3 29 kkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                             k ++  + +l++  s ++Wev++  ++++    +t+GW++F+ a++L+ gD+++Fk++g++ f
  Rsa1.0_00092.1_g00047.1 39 K-KRAEKAKLRSkASDKTWEVTI--DGRR----FTRGWNDFATAHDLRIGDIIIFKHEGDMVF 94
                             3.35568999996677*******..9998....9**********************9998766 PP

2B364.61.5e-20971751897
                              --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                       B3  18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                              lp + ++++ ++k+++ ++++ +++g+sW+ +l +r ++g+y++++GW++F+++n+Lk+gD ++F l+g+ ++++++ ++
  Rsa1.0_00092.1_g00047.1  97 LPMEATSSNALNKRCH-EMIVVNKEGNSWNANLGFRESRGSYYIRGGWRRFCRDNRLKVGDLMMFNLVGDGKTSPMICIL 175
                              8999999*****9887.9999*************************************************9999999886 PP

3B333.29.5e-111742551799
                              E--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT.--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkang.LkegDfvvFkldgrsefelvvkvfrk 99 
                              +lp +f++ +g++k+   +++l+d++g +  +kl    +k+ g+  l+kGWk+F++a + Lk g+ ++++l+++ +  lv+k+++k
  Rsa1.0_00092.1_g00047.1 174 ILPATFMKINGINKK--NEIILMDKHGVKRVIKLVKdeSKY-GKRGLGKGWKDFCEASDvLKIGERFMLELIWE-DSVLVLKFCSK 255
                              79*****88888854..59********99999997753333.33679**********99356***********5.55579999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.08E-131394IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-141395IPR015300DNA-binding pseudobarrel domain
CDDcd100171.24E-101791No hitNo description
SMARTSM010192.5E-81996IPR003340B3 DNA binding domain
PfamPF023624.2E-83992IPR003340B3 DNA binding domain
PROSITE profilePS508638.0784794IPR003340B3 DNA binding domain
PfamPF023622.6E-1997176IPR003340B3 DNA binding domain
SMARTSM010196.6E-1297178IPR003340B3 DNA binding domain
CDDcd100175.05E-1797176No hitNo description
PROSITE profilePS5086313.22597178IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-1597168IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-1798170IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-13174255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-12174255IPR015300DNA-binding pseudobarrel domain
CDDcd100171.18E-10174254No hitNo description
SMARTSM010191.6E-4179256IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MNYLKMANPP LQSPTNPHFF QSLLPDNTGC LLFKVHRSKK RAEKAKLRSK ASDKTWEVTI  60
DGRRFTRGWN DFATAHDLRI GDIIIFKHEG DMVFNDLPME ATSSNALNKR CHEMIVVNKE  120
GNSWNANLGF RESRGSYYIR GGWRRFCRDN RLKVGDLMMF NLVGDGKTSP MICILPATFM  180
KINGINKKNE IILMDKHGVK RVIKLVKDES KYGKRGLGKG WKDFCEASDV LKIGERFMLE  240
LIWEDSVLVL KFCSKVKVET LCN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412566.11e-108hypothetical protein EUTSA_v10026818mg, partial
TrEMBLA0A0D3DH861e-108A0A0D3DH86_BRAOL; Uncharacterized protein
STRINGBra023988.1-P2e-91(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.14e-30B3 family protein